PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g028850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 1121aa    MW: 127553 Da    PI: 10.1184
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g028850.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.23.4e-141499195
                    EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                    ffk l     ++++ l +p  f++++ +g ++++kt +l++  s  +W vk+  ++ +    lt+GW++F++a++L+ gD+vvF+++g++ f  +v+
  Csa03g028850.1 14 FFKPL--LPGFRTH-LNIPIAFFSKYvEGRNHQNKTPKLRSdASDITWLVKM--DGLK----LTDGWEDFASAHDLRIGDIVVFRHEGEMVF--HVT 99
                    67777..6677777.99**********777789999999987888*******..6666....***********************9998888..665 PP

2B362.66.3e-20156246798
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     ++  l+++r ++p +fa+++g++k ++k++ l++ +grsW++ l ++k++ +++l +GW++F++ang+++g   +Fkl++ +++ +v+++ r
  Csa03g028850.1 156 SAWGLSNDRQYIPITFARSNGLNKMRGKKIYLRNDEGRSWKLGLEHDKTGVHTYLISGWRRFCDANGINQGQQHTFKLVR-RSAPPVIRLSR 246
                     5667899**************************************9****9***************************98.56668887766 PP

3B368.68.5e-22271362598
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      +++++l++++l+lp++f++ hg++k++s +++l++e+g +W + l+++k+ + ++l+kGW +F++ ng+k gD++ Fkl+g +++e+v++++ 
  Csa03g028850.1 271 SVSPSSLSNDQLYLPRSFVSLHGLEKRCS-EIILKNEQGSKWPLVLKHTKSINLTYLKKGWTSFCDFNGIKIGDSFKFKLSG-TCEEPVLSLCP 362
                     56789999*****************9998.****************99999999**************************99.88889999986 PP

4B366.63.6e-21451542799
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     ++ +l+s+r ++p +fa+ +g++k ++k++ l +e+grsW++ l ++k++ +++l++GW++F++ang+ +g   +Fkl++ +++ +v++++r+
  Csa03g028850.1 451 SAWTLSSDRQYIPITFARLNGLNKMRGKKIYLHNEEGRSWRLGLEHDKTGMHTYLKSGWRRFCSANGISQGQQHTFKLVR-RSAPPVIRLCRA 542
                     5678899***********************************************************************98.67779***9996 PP

5B365.57.7e-21564653598
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     ++++ +l++++l+lp++f+ ++g++k++s +++l++ +g +W + l  + ++++++l+kGW++F++ n++k+gD++ Fkl+g + +e+v++++ 
  Csa03g028850.1 564 FVNPLSLRNDLLYLPRNFVISNGLDKRCS-EIVLKNGEGIKWHLVL--KHYKSATYLKKGWSSFCQVNRIKAGDSFKFKLVG-TWKEPVLSLCP 653
                     56777899******************998.****************..999999**************************99.78888998886 PP

6B366.24.7e-21743831594
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      +++++l+++rl+lp +f +++g++k ++k+++l +e+grsW+++l y+k++ +++ + GWk+F++ang+ +g  ++F+l++ +++ +v+
  Csa03g028850.1 743 NVTASSLNEDRLYLPLRFERSNGLDKMSGKKIVLLNEEGRSWKLNLAYNKSGMHTYARPGWKRFCDANGMSQGQQFTFELVQ-KSAPPVM 831
                     57899999***********************************************************************998.5655655 PP

7B361.11.9e-19855944697
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     +++++l+++ l+l ++f++++g++k ++ ++tl++e+gr+ ++ l++  +++ +++++GW +F+++ngLk++D++ Fkl++ +++++ ++++
  Csa03g028850.1 855 VTASSLNKDKLYLWRSFVRSNGLDKGCN-KMTLKNEWGRERTLVLKHYESKRFTIIKRGWTSFCQDNGLKARDSFKFKLVE-TGENPILSLC 944
                     6788899999**************9886.****************99999999*************************998.6777888777 PP

8B360.72.4e-1910201116199
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3    1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93  
                      f++ +++ +++ ++ l lp+ f++ +g++k  ++++tl  ++g  W v l  +kk g++ ++kGWk+F++a+g+k+g++++++l++++e+++v
  Csa03g028850.1 1020 FVTLTLTQSAFHNSKLFLPRGFTKVNGINK--PRKITLLGQDGVIWVVDLYQEKKCGTMRFGKGWKQFCEAQGVKVGESFMLELIWEDEASPV 1110
                      667778899999999********9999995..558***************66888888********************************9** PP

                      EEEE-S CS
              B3   94 vkvfrk 99  
                      +k++ k
  Csa03g028850.1 1111 LKFCTK 1116
                      **9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.6E-209115IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-1810111IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.30711104IPR003340B3 DNA binding domain
CDDcd100172.43E-131299No hitNo description
SMARTSM010191.8E-2014104IPR003340B3 DNA binding domain
PfamPF023621.9E-82196IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.9E-15145241IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.94E-15146244IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.93150248IPR003340B3 DNA binding domain
SMARTSM010195.9E-23151248IPR003340B3 DNA binding domain
PfamPF023622.0E-17156246IPR003340B3 DNA binding domain
CDDcd100171.73E-12160246No hitNo description
Gene3DG3DSA:2.40.330.108.1E-20260362IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.67E-20265364IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.198267363IPR003340B3 DNA binding domain
CDDcd100173.61E-18267362No hitNo description
SMARTSM010191.3E-24268364IPR003340B3 DNA binding domain
PfamPF023625.9E-21271363IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.2E-17438540IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-16441545IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.987445543IPR003340B3 DNA binding domain
CDDcd100174.13E-13445541No hitNo description
SMARTSM010194.2E-24446543IPR003340B3 DNA binding domain
PfamPF023622.0E-19450542IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.9E-19553653IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-18555653IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.803560654IPR003340B3 DNA binding domain
SMARTSM010194.6E-24561655IPR003340B3 DNA binding domain
PfamPF023626.0E-19564654IPR003340B3 DNA binding domain
CDDcd100173.32E-14575643No hitNo description
Gene3DG3DSA:2.40.330.102.8E-19732831IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-18733831IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.649739837IPR003340B3 DNA binding domain
CDDcd100171.44E-14739834No hitNo description
SMARTSM010192.3E-25740837IPR003340B3 DNA binding domain
PfamPF023625.5E-20742833IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-18842945IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.02E-18846948IPR015300DNA-binding pseudobarrel domain
CDDcd100171.51E-17850945No hitNo description
PROSITE profilePS5086311.674850946IPR003340B3 DNA binding domain
SMARTSM010191.4E-27851947IPR003340B3 DNA binding domain
PfamPF023624.0E-19854945IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-1910131115IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.67E-2010171115IPR015300DNA-binding pseudobarrel domain
CDDcd100171.76E-1410191105No hitNo description
PROSITE profilePS5086313.78910201117IPR003340B3 DNA binding domain
SMARTSM010195.1E-2210201117IPR003340B3 DNA binding domain
PfamPF023621.5E-1810201116IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1121 aa     Download sequence    Send to blast
MADQSLYSPI KPHFFKPLLP GFRTHLNIPI AFFSKYVEGR NHQNKTPKLR SDASDITWLV  60
KMDGLKLTDG WEDFASAHDL RIGDIVVFRH EGEMVFHVTA LGPSCCEIQY TSSSSHNIND  120
DDETNIVSRN SLRVKKNSRK KMECSSNPFR FVAKVSAWGL SNDRQYIPIT FARSNGLNKM  180
RGKKIYLRND EGRSWKLGLE HDKTGVHTYL ISGWRRFCDA NGINQGQQHT FKLVRRSAPP  240
VIRLSRPKPR PKQRSESESE SPLDHSCFQG SVSPSSLSND QLYLPRSFVS LHGLEKRCSE  300
IILKNEQGSK WPLVLKHTKS INLTYLKKGW TSFCDFNGIK IGDSFKFKLS GTCEEPVLSL  360
CPAEPNRAKT PLKCSEGSDD DVNPEESKEE KNISQECLEI KKRKYQPRCR ASVENMDDDQ  420
THIGNSSRVK KNPRKKVESS SNHSRFVAKV SAWTLSSDRQ YIPITFARLN GLNKMRGKKI  480
YLHNEEGRSW RLGLEHDKTG MHTYLKSGWR RFCSANGISQ GQQHTFKLVR RSAPPVIRLC  540
RAKPKPKQRS ETESASDNSC FEGFVNPLSL RNDLLYLPRN FVISNGLDKR CSEIVLKNGE  600
GIKWHLVLKH YKSATYLKKG WSSFCQVNRI KAGDSFKFKL VGTWKEPVLS LCPAESNREK  660
NPSKCSEGID DVKPEESEEE SNEDKNISQN CLGIKKRKSQ SRYKASVENM DDDQTNIGNS  720
SRVKKNPRKK VKSSSDHSSF VANVTASSLN EDRLYLPLRF ERSNGLDKMS GKKIVLLNEE  780
GRSWKLNLAY NKSGMHTYAR PGWKRFCDAN GMSQGQQFTF ELVQKSAPPV MRLYLAKHRP  840
KSESSSHHSY FVGSVTASSL NKDKLYLWRS FVRSNGLDKG CNKMTLKNEW GRERTLVLKH  900
YESKRFTIIK RGWTSFCQDN GLKARDSFKF KLVETGENPI LSLCPADSNR DKTPLEYAEG  960
IDNVKSLSSS PSSGDDSSRS KKSEDESIED KNISQDCLEI KKRKYCLNCR ASSSYTPNRF  1020
VTLTLTQSAF HNSKLFLPRG FTKVNGINKP RKITLLGQDG VIWVVDLYQE KKCGTMRFGK  1080
GWKQFCEAQG VKVGESFMLE LIWEDEASPV LKFCTKVNSA *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010499009.10.0PREDICTED: B3 domain-containing protein REM17-like
SwissprotQ84WP30.0REM17_ARATH; B3 domain-containing protein REM17
TrEMBLD7KQM90.0D7KQM9_ARALL; T24P13.6
TrEMBLR0GPB90.0R0GPB9_9BRAS; Uncharacterized protein
STRINGscaffold_102864.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57811648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.10.0B3 family protein